PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0049s0260.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 787aa    MW: 86582.4 Da    PI: 6.9804
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0049s0260.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17e-096206561953
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                             Fe   ++yp+ +++  LA+++gL+ +qV++WF N R+
  SapurV1A.0049s0260.1.p 620 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARI 656
                             554459****************************996 PP

2BELL51.32.9e-17493537448
                    BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakp 48 
                             e q+ kakLl l+eeV++rYkqy+ q+q+v++ Fe va l +a+p
  SapurV1A.0049s0260.1.p 493 EYQQEKAKLLFLQEEVCRRYKQYHRQMQMVAATFESVASLSAATP 537
                             78999*************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-18395548IPR006563POX domain
PfamPF075263.8E-23400541IPR006563POX domain
PROSITE profilePS5007110.576598655IPR001356Homeobox domain
SMARTSM003896.1E-4601665IPR001356Homeobox domain
CDDcd000865.93E-10601655No hitNo description
Gene3DG3DSA:1.10.10.603.5E-22604655IPR009057Homeodomain-like
SuperFamilySSF466898.13E-14604656IPR009057Homeodomain-like
PfamPF059204.3E-17618655IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 787 aa     Download sequence    Send to blast
MMQSRRDKLR DQQSLTSDQN FDDCPNSLEG ISVHPGLSPD LVNVQNIRSA DTIYDSTMFS  60
SEMLNFATSS HALSAPKVSI VDQELGAVPL NRPILAEESS LTGMSHPVLS NFNASPKASS  120
CDPQGCCNWR SLDSHQSYDL MANYAGGSVV GGRNQKPMFV GKVSSNNARI SNISTSRQYL  180
MPSYIGNQNL QLPSTLRNTF GEISSEDSIK QLKVMMQSPS PPPYQNALQD VIPSGCFRSR  240
MNERVLHPSY VTESTASHFD NNGSTWMSRP LEDYPRWSTG ELGLVERTRD RETRTVLGDA  300
NTQGLSLSLS SINPPSEAEA TQFGEEYASE HLLSKVVDRV SQESHQDSEF SKPSSPCALP  360
KPSIINKSWG KSIHDIVGTS TLAIGNNTAP LGPFTGYATI LKSSKFLMPA QQLLEEFSSS  420
RTGPKFTRAF EMSEDQVTAP ALADIVNEAY KKAGTNTENY SGIQYSTFYR SNKPSGGGDA  480
GGRGGSCGSY GPEYQQEKAK LLFLQEEVCR RYKQYHRQMQ MVAATFESVA SLSAATPNFR  540
SLKHGISGQL RLVTKARGDS LFSWNTVAGG SKGDARLLYM DQRNKSGGAS VGYREPQQHV  600
WRPQRGLPEP SVAILRAWLF EHFLHPYPTD TDKHMLATQT GLSRNQVSNW FINARIDGIS  660
SAEGNNIQSN HEETSNKLGS NSMLNKQLEC SGISSSGSSG EQLDEEQWSE EKRSRVEFQV  720
PTTMDGSLMN FLPYQRSRVD DGGAVSLTLG LRQGIEIALH QIHLQQHRGR FKQQPFGGHM  780
IHDFAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314291.10.0homeodomain-containing family protein
TrEMBLB9HQD00.0B9HQD0_POPTR; Homeodomain-containing family protein
STRINGPOPTR_0009s01520.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.12e-63BEL1-like homeodomain 8